Skip to product information
1 of 1

ABclonal

Recombinant Human FGF-3 Protein - RP01404

Recombinant Human FGF-3 Protein - RP01404

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FGF-3 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01404-10, RP01404-20, RP01404-50, RP01404-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FGF-3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asp28-Arg212 (N-Met) ) of human FGF-3 (Accession #NP_005238.1) fused with no additional amino acid.

Alternate Names: FGF3, HBGF-3, INT2

SWISS: P11487

GeneID: 2248

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Fibroblast Growth Factor 3 (FGF-3) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. They act on cells of mesodermal and neuroectodermal origin to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects and tissue repair. Signaling receptors for FGFs are type I transmembrane receptor tyrosine kinases belonging to the Ig superfamily. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. Through alternative splicing, multiple isoforms for FGF R1, 2 and 3, with distinct ligand recognition profiles, are also generated.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 25mM Tris,1M NaCl,1mM TCEP,pH 8.0

Antigen Sequence: DAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRR

Endotoxin: Please contact us for more information.

Research Use Only

View full details