ABclonal
Recombinant Human FGF-3 Protein - RP01404
Recombinant Human FGF-3 Protein - RP01404
Couldn't load pickup availability
Recombinant Human FGF-3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01404-10, RP01404-20, RP01404-50, RP01404-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FGF-3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asp28-Arg212 (N-Met) ) of human FGF-3 (Accession #NP_005238.1) fused with no additional amino acid.
Alternate Names: FGF3, HBGF-3, INT2
SWISS: P11487
GeneID: 2248
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Fibroblast Growth Factor 3 (FGF-3) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. They act on cells of mesodermal and neuroectodermal origin to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects and tissue repair. Signaling receptors for FGFs are type I transmembrane receptor tyrosine kinases belonging to the Ig superfamily. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. Through alternative splicing, multiple isoforms for FGF R1, 2 and 3, with distinct ligand recognition profiles, are also generated.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 25mM Tris,1M NaCl,1mM TCEP,pH 8.0
Antigen Sequence: DAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRR
Endotoxin: Please contact us for more information.
Research Use Only
