Skip to product information
1 of 2

Elabscience

Recombinant Human FGF-3 protein(N-His)(active) - PKSH034149

Recombinant Human FGF-3 protein(N-His)(active) - PKSH034149

Regular price $348.60 CAD
Regular price Sale price $348.60 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FGF-3 protein(N-His)(active)

Sizes: 20μg, 100μg

Catalogue Numbers: PKSH034149-20, PKSH034149-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: FGF-3

Target Symptom: HBGF-3; INT2

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: P11487

Accession: P11487

Background: Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal ear development.

Activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 78 ng/mL.

Sequence: MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH

Purity: > 95 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 27.71 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details