Skip to product information
1 of 1

ABclonal

Recombinant Human FGF-4 Protein - RP01712

Recombinant Human FGF-4 Protein - RP01712

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FGF-4 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP01712-10, RP01712-20, RP01712-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FGF-4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly25-Leu206) of human FGF-4 (Accession #NP_001998.1) fused with no additional amino acid.

Alternate Names: HST; KFGF; FGF-4; HST-1; HSTF1; K-FGF; HBGF-4; HSTF-1; FGF4

SWISS: P08620-1

GeneID: 2249

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: FGF (fibroblast growth factor) signalling is known to be required for many aspects of mesoderm formation and patterning during Xenopus development and has been implicated in regulating genes required for the specification of both blood and skeletal muscle lineages. Fibroblast growth factor 4 (FGF4) signaling induces differentiation from embryonic stem cells (ESCs) via the phosphorylation of downstream molecules such as mitogen-activated protein kinase/extracellular signal-related kinase (MEK) and extracellular signal-related kinase 1/2 (ERK1/2). Fibroblast Growth Factor 4 (FGF-4) could not only increase the proliferation of bone marrow mesenchymal stem cells (BMSCs), but also induce BMSCs into hepatocyte-like cells in vitro. FGF4 transduced BMSCs contributed to liver regeneration might by the transplanted microenvironment. The FGF4-bFGF BMSCs thus can enhance the survival of the transplanted cells, diminish myocardial fibrosis, promote myocardial angiogenesis, and improve cardiac functions.

Source: E. coli

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details