WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human FGF-7/HBGF-7/KGF Protein - RP01717

Recombinant Human FGF-7/HBGF-7/KGF Protein - RP01717

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human FGF-7/HBGF-7/KGF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01717-10, RP01717-20, RP01717-50, RP01717-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FGF-7/HBGF-7/KGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys32-Thr194) of human FGF-7/HBGF-7 (Accession #NP_002000.1) fused with His tag at the C-terminus.

Alternate Names: KGF; HBGF-7; FGF7

SWISS: P21781-1

GeneID: 2252

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Fibroblast growth factor 7 (FGF7) is a member of the fibroblast growth factor (FGF) family of proteins. FGF7 plays an important role in regulating the proliferation, migration, and differentiation of cells. FGF7 is of stromal origin and produces a paracrine effect on epithelial cells. FGF7 is a mesenchyme-specific heparin-binding growth factor that binds FGF receptor 2 (FGFR2) to regulate numerous cellular and physiological processes. FGF7/FGFR2 promotes invasion and migration in human gastric cancer. FGF7 is specifically utilized as a paracrine factor during the process of differentiation of the epidermal layers in the regenerating scales and in particular for beta-cells differentiation. FGF7 over expression is associated with advanced clinical features in patients with upper tract and bladder urothelial carcinoma, justifying its potential prognostic value for urothelial carcinoma.

Bio-Activity: Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cells. The ED50 for this effect is 2.19-8.76 ng/mL, corresponding to a specific activity of 1.14×105~4.57×105 units/mg.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only