Recombinant Human FGFR-3 alpha (IIIc)/CD333 Protein
Sizes: 50ug, 100ug
Catalogue Number: RP00144-50, RP00144-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FGFR-3 alpha (IIIc)/CD333 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu23-Gly375) of human FGFR3/CD333 (Accession #NP_000133.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: ACH, CD333, CEK2, HSFGFR3EX, JTK4, FGFR3
SWISS: P22607
GeneID: 2261
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: FGFR3, also known as CD333, is a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. FGFRs are transmembrane catalytic receptors that have intracellular tyrosine kinase activity. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human FGF1 at 5 μg/mL (100 μL/well) can bind Recombinant Human FGFR3 with a linear range of 0.5-1.5 μg/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only