Recombinant Human Fibrillin-1/FBN1 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02988-10, RP02988-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Fibrillin-1/FBN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2732-His2871) of human Fibrillin-1/FBN1 (Accession #NP_000129.3) fused with a 8×His tag at the N-terminus.
Alternate Names: Fibrillin-1; Fbn1; Asprosin; Fbn-1
SWISS: P35555
GeneID: 2200
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only