Skip to product information
1 of 1

ABclonal

Recombinant Human Fibrillin-1/FBN1 Protein - RP02988

Recombinant Human Fibrillin-1/FBN1 Protein - RP02988

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Fibrillin-1/FBN1 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02988-10, RP02988-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Fibrillin-1/FBN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2732-His2871) of human Fibrillin-1/FBN1 (Accession #NP_000129.3) fused with a 8×His tag at the N-terminus.

Alternate Names: Fibrillin-1; Fbn1; Asprosin; Fbn-1

SWISS: P35555

GeneID: 2200

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details