Recombinant Human Fibrinogen like 1/FGL1 Protein
Sizes: 10ug, 100ug
Catalogue Number: RP01268LQ-10, RP01268LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Fibrinogen like 1/FGL1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-IIe312) of Human Fibrinogen like 1/FGL1 (Accession #NP_004458.3) fused with a 6×His tag at the C-terminus.
Alternate Names: FGL1, HFREP1, HP-041, LFIRE-1, LFIRE1
SWISS: Q08830-1
GeneID: 2267
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized recombinant Human FGL1 at 5 μg/mL (100 μL/well) can bind recombinant Human LAG3 with a linear range of 0.5-21.6 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human FGL1 at 1 μg/mL (100 μL/well) can bind FGL1 Rabbit mAb with a linear range of 1-27.5 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Supplied as a 0.22 μm filtered solution in 20mM Tris,300mM NaCl,10% Glycerol,pH 8.0Contact us for customized product form or formulation.
Antigen Sequence: MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Endotoxin: Please contact us for more information.
Research Use Only