Skip to product information
1 of 1

ABclonal

Recombinant Human Flt3 ligand/Flt3L Protein - RP00175

Recombinant Human Flt3 ligand/Flt3L Protein - RP00175

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Flt3 ligand/Flt3L Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00175-10, RP00175-20, RP00175-50, RP00175-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Flt3 ligand/Flt3L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr27-Pro185) of human FLT3L/Flt3 ligand/FLT3LG (Accession #NP_001450.2) fused with a 6×His tag at the C-terminus.

Alternate Names: FL, FLT3L, FLT3LG, FLT3LG

SWISS: P49771

GeneID: 2323

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: FLT3LG, also known as flt3 ligand, is a small molecule that acts as a growth factor that increases the number of immune cells by activating the hematopoietic progenitors.FLT3LG is expressed as a noncovalently-linked dimer by T cells and bone marrow and thymic fibroblasts. Alternate splicing of human FLT3LG also generates membrane-associated isoforms that contain either a truncated cytoplasmic tail or an 85 aa substitution following the cytokine domain. Both transmembrane and soluble FLT3LG signal through the tyrosine kinase receptor Flt-3/Flk-2. FLT3LG induces the expansion of monocytes and immature dendritic cells as well as early B cell lineage differentiation. It synergizes with IL-3, GM-CSF, and SCF to promote the mobilization and myeloid differentiation of hematopoietic stem cells. It cooperates with IL-2, -6, -7, and -15 to induce NK cell development and with IL-3, -7, and -11 to induce terminal B cell maturation.

Bio-Activity: 1、Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Flt3 ligand at 2 μg/mL (100 μL/well) can bind Recombinant Human Flt-3 with a linear range of 0.128-3.97 ng/mL.2、Measured in a cell proliferation assay using Human OCI-AML5 cells. The ED50 for this effect is 0.09-0.36 ng/mL, corresponding to a specific activity of 2.78×10^6 ~1.11×10^7 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details