Recombinant Human Flt3 ligand/Flt3L Protein - RP02360

Recombinant Human Flt3 ligand/Flt3L Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02360-10, RP02360-20, RP02360-50, RP02360-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FLT3 ligand Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Thr27-Pro185) of Human FLT3 ligand fused with a hFc at the C-terminal.

Alternate Names: FL, FLT3L, FLT3LG, FLT3LG

SWISS: P49771

GeneID: 2323

Species: Human

Purity: ≥ 95 % as determined by Tris-Bis PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured in a cell proliferation assay using Human OCI-AML5 cells. The ED50 for this effect is 1.56-6.24 ng/mL, corresponding to a specific activity of 1.60×10^5 ~6.41×10^5 units/mg.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only