Skip to product information
1 of 1

ABclonal

Recombinant Human Flt4 ligand/VEGF-C Protein - RP01173

Recombinant Human Flt4 ligand/VEGF-C Protein - RP01173

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Flt4 ligand/VEGF-C Protein

Sizes: 20ug, 50ug

Catalogue Number: RP01173-20, RP01173-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Flt4 ligand/VEGF-C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr103-Arg227) of human VEGF-C/Flt4-L/VRP (Accession #NP_005420.1) fused with a 6×His tag at the C-terminus.

Alternate Names: VEGFC, Flt4-L, LMPH1D, VRP

SWISS: P49767

GeneID: 7424

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGF-C at 0.5 μg/mL (100 μL/well) can bind Recombinant Human VEGFR3 with a linear range of 3.92-15.70 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details