Recombinant Human Flt4 ligand/VEGF-C Protein
Sizes: 20ug, 50ug
Catalogue Number: RP01173-20, RP01173-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Flt4 ligand/VEGF-C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr103-Arg227) of human VEGF-C/Flt4-L/VRP (Accession #NP_005420.1) fused with a 6×His tag at the C-terminus.
Alternate Names: VEGFC, Flt4-L, LMPH1D, VRP
SWISS: P49767
GeneID: 7424
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGF-C at 0.5 μg/mL (100 μL/well) can bind Recombinant Human VEGFR3 with a linear range of 3.92-15.70 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only