Recombinant Human Follicle Stimulating Hormone (FSH) (CGA&FSHB) Protein
Sizes: 20ug, 50ug
Catalogue Number: RP01695-20, RP01695-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Follicle Stimulating Hormone (FSH) (CGA&FSHB) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala 25-Ser116＆Asn19-Glu129) of human Follicle Stimulating Hormone (FSH) (CGA&FSHB) (Accession #NP_000726.1＆NP_000501.1) fused with and a 6×His tag at the C-terminus(CGA).
Alternate Names: HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA&HH24, CGA&FSHB; Follicle Stimulating Hormone (FSH) (CGA&FSHB)
SWISS: P01215＆P01225
GeneID: 1081&2488
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.
Source: HEK293 cells
Tag: C-His(CGA)&No tag(SHB)
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only