ABclonal
Recombinant Human Follistatin/Follistatin 288/FST Protein - RP00376
Recombinant Human Follistatin/Follistatin 288/FST Protein - RP00376
Couldn't load pickup availability
Recombinant Human Follistatin/Follistatin 288/FST Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00376-10, RP00376-20, RP00376-50, RP00376-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Follistatin/Follistatin 288/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Asn317) of human Follistatin/Follistatin 288/FST (Accession #P19883) with a hFC at the N-terminus..
Alternate Names: FST, FS
SWISS: P19883
GeneID: 10468
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
Bio-Activity: Measured by its ability to neutralize Activin-mediated erythroid differentiation of K562 human chronic myelogenous leukemia cells. The ED50 for this effect is 0.1-0.4 μg/mL in the presence of 7.5 ng/mL of rhActivin A.
Source: HEK293 cells
Tag: N-hFC
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVC
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
