Recombinant Human Follistatin/Follistatin 315/FST Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01249-10, RP01249-20, RP01249-50, RP01249-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Follistatin/Follistatin 315/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Trp344) of human Follistatin (Accession #NP_037541.1) fused with a 6×His tag at the C-terminus.
Alternate Names: FST, FS
SWISS: P19883
GeneID: 10468
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant Human Inhibin beta A at 0.5 μg/mL (100 μL/well) can bind recombinant Human FST, the EC50 of Human FST is 7.1 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only