ABclonal
Recombinant Human Frizzled-2/FZD2 Protein - RP01422
Recombinant Human Frizzled-2/FZD2 Protein - RP01422
Couldn't load pickup availability
Recombinant Human Frizzled-2/FZD2 Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP01422-10, RP01422-50, RP01422-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Frizzled-2/FZD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Leu163) of human Frizzled-2/FZD2 (Accession #NP_001457.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: Fz2, fz-2, fzE2, hFz2, OMOD2, FZD2
SWISS: Q14332
GeneID: 2535
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Frizzled-2 (FZD2) is also known as FzE2, which belongs to the G-protein coupled receptor Fz/Smo family. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. FZD2 contains one FZ (frizzled) domain. FZD2 may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. The Lys-Thr-X-X-X-Trp motif of FZD2 interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPAL
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
