Skip to product information
1 of 1

ABclonal

Recombinant Human Frizzled-2/FZD2 Protein - RP01422

Recombinant Human Frizzled-2/FZD2 Protein - RP01422

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Frizzled-2/FZD2 Protein

Sizes: 10ug, 50ug, 100ug

Catalogue Numbers: RP01422-10, RP01422-50, RP01422-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Frizzled-2/FZD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Leu163) of human Frizzled-2/FZD2 (Accession #NP_001457.1) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: Fz2, fz-2, fzE2, hFz2, OMOD2, FZD2

SWISS: Q14332

GeneID: 2535

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Frizzled-2 (FZD2) is also known as FzE2, which belongs to the G-protein coupled receptor Fz/Smo family. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. FZD2 contains one FZ (frizzled) domain. FZD2 may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. The Lys-Thr-X-X-X-Trp motif of FZD2 interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPAL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details