Skip to product information
1 of 1

ABclonal

Recombinant Human Frizzled-4/FZD4/CD344 Protein - RP01377

Recombinant Human Frizzled-4/FZD4/CD344 Protein - RP01377

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Frizzled-4/FZD4/CD344 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01377-10, RP01377-20, RP01377-50, RP01377-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Frizzled-4/FZD4/CD344 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe37-Glu180) of human FZD4/CD344/EVR1 (Accession #NP_036325.2) fused with a hFc, 6×His tag at the C-terminus.

Alternate Names: FZD4, CD344, EVR1, FEVR, FZD4S, Fz-4, Fz4, FzE4, GPCR, hFz4

SWISS: Q9ULV1

GeneID: 8322

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Frizzled-4 (FZD4) is also known as FzE4, CD344, which belongs to the G-protein coupled receptor Fz/Smo family. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes.Familial exudative vitreoretinopathy (FEVR) is a hereditary blinding disorder that features defects in retinal vascular development. Mutations in FZD4 are known to cause autosomal dominant exudative vitreoretinopathy (EVR1). The mutations in FZD4 are associated with the phenotypes of retinal folds or ectopic macula in FEVR.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details