Skip to product information
1 of 1

ABclonal

Recombinant Human Frizzled-5/FZD5 Protein - RP01057

Recombinant Human Frizzled-5/FZD5 Protein - RP01057

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Frizzled-5/FZD5 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01057-10, RP01057-20, RP01057-50, RP01057-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Frizzled-5/FZD5 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Pro167) of human Frizzled-5 (Accession #NP_003459.2.) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: FZD5, C2orf31, HFZ5

SWISS: Q13467

GeneID: 7855

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details