Recombinant Human Frizzled-7/FZD7 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00204-10, RP00204-20, RP00204-50, RP00204-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Frizzled-7/FZD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln33-Leu185) of human Frizzled-7 (Accession #NP_003498.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: FZD7, FzE3
SWISS: O75084
GeneID: 8324
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Frizzled-7 is a member of the Frizzled family of unconventional G-protein-coupled glycoprotein receptors for the Wnt signaling pathway. During development, Frizzled-7 is expressed during gastrulation and in the fetal gut, kidney and lung where it is thought to influence tissue morphogenesis via non-canonical signaling pathways. In the adult, Frizzled-7 is expressed in skeletal muscle, especially in satellite cells that mediate muscle regeneration in response to Wnt-7a. It is expressed in embryonic stem cells (ES), contributing to self-renewal signaling. Frizzled-7 expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human Glypican-3 Protein at 5 μg/mL (100 μL/well) can bind Human FZD7 with a linear range of 4.88-935.5 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human Glypican-3 Protein at 5 μg/mL (100 μL/well) can bind Human FZD7 with a linear range of 4.88-520.4 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only