ABclonal
Recombinant Human FSH Beta Protein - RP01821
Recombinant Human FSH Beta Protein - RP01821
Couldn't load pickup availability
Recombinant Human FSH Beta Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01821-10, RP01821-20, RP01821-50, RP01821-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FSH Beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Glu129) of human FSH Beta (Accession #NP_000501.1) fused with a 6×His tag at the C-terminus.
Alternate Names: HH24; FSHB; FSH Beta; fshb
SWISS: P01225
GeneID: 2488
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
