Skip to product information
1 of 1

ABclonal

Recombinant Human FSH Beta Protein - RP01821

Recombinant Human FSH Beta Protein - RP01821

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FSH Beta Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01821-10, RP01821-20, RP01821-50, RP01821-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FSH Beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Glu129) of human FSH Beta (Accession #NP_000501.1) fused with a 6×His tag at the C-terminus.

Alternate Names: HH24; FSHB; FSH Beta; fshb

SWISS: P01225

GeneID: 2488

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details