Skip to product information
1 of 1

Elabscience

Recombinant Human Galectin-10 protein(N-His) - PKSH034186

Recombinant Human Galectin-10 protein(N-His) - PKSH034186

Regular price $1,034.60 CAD
Regular price Sale price $1,034.60 CAD
Sale Sold out
Quantity

Get a quote

Recombinant Human Galectin-10 protein(N-His)

Size: 100μg

Catalogue Number: PKSH034186-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: Galectin-10

Target Symptom: GAL10; Gal-10; LGALS10; LGALS10A; LPPL_HUMAN

Target Species: Human

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: Q05315

Accession: Q05315

Background: Regulates immune responses through the recognition of cell-surface glycans. Essential for the anergy and suppressive function of CD25-positive regulatory T-cells (Treg).

Sequence: MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 17.28 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details