Elabscience
Recombinant Human Galectin-16 protein(N-His) - PKSH034190
Recombinant Human Galectin-16 protein(N-His) - PKSH034190
Couldn't load pickup availability
Recombinant Human Galectin-16 protein(N-His)
Size: 100μg
Catalogue Number: PKSH034190-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: Galectin-16
Target Symptom: LGALS16
Target Species: Human
Expression Host: E.coli
Fusion Tag: N-His
UNIProt ID: A8MUM7
Accession: A8MUM7
Sequence: MSFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 17.42 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
