WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Galectin-3/LGALS3 Protein - RP00057

Recombinant Human Galectin-3/LGALS3 Protein - RP00057

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Human Galectin-3/LGALS3 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00057-10, RP00057-20, RP00057-50, RP00057-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Galectin-3/LGALS3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Ile250) of human Galectin-3 (Accession #NP_002297.2).

Alternate Names: CBP35, GAL3, GALBP, GALIG, L31, LGALS2, MAC2, LGALS3, GAL3, GALBP, GALIG, L31, LGALS2, MAC2

SWISS: P17931

GeneID: 3958

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human Galectin-3 at 1 μg/mL (100 μL/well) can bind Galectin-3/LGALS3 Rabbit mAb with a linear range of 0.24-35 ng/mL.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only