Elabscience
Recombinant Human Galectin-4 protein(N-His)(active) - PKSH034184
Recombinant Human Galectin-4 protein(N-His)(active) - PKSH034184
Couldn't load pickup availability
Recombinant Human Galectin-4 protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSH034184-20, PKSH034184-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: Galectin-4
Target Symptom: LGALS4; GAL4; L36LBP
Target Species: Human
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P56470
Accession: P56470
Background: Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
Activity: Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is < 8 μg/mL.
Sequence: MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 36.77 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
