WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Galectin-4 protein(N-His)(active) - PKSH034184
Recombinant Human Galectin-4 protein(N-His)(active) - PKSH034184

Recombinant Human Galectin-4 protein(N-His)(active) - PKSH034184

Regular price
$348.60
Regular price
Sale price
$348.60
Unit price
per 
Availability
Sold out

Recombinant Human Galectin-4 protein(N-His)(active)

Sizes: 20μg, 100μg

Catalogue Numbers: PKSH034184-20, PKSH034184-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: Galectin-4

Target Symptom: LGALS4; GAL4; L36LBP

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: P56470

Accession: P56470

Background: Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.

Activity: Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is < 8 μg/mL.

Sequence: MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 36.77 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only