ABclonal
Recombinant Human Gastric inhibitory polypeptide/GIP Protein - RP01818
Recombinant Human Gastric inhibitory polypeptide/GIP Protein - RP01818
Couldn't load pickup availability
Recombinant Human Gastric inhibitory polypeptide/GIP Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01818-10, RP01818-20, RP01818-50, RP01818-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human GIP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr52-Gln93) of human GIP (Accession #NP_004114.1) fused with a hFc tag at the N-terminus.
Alternate Names: GIP; Incretin; Gastric inhibitory polypeptide
SWISS: P09681
GeneID: 2695
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The potential application of glucose-dependent insulinotropic polypeptide (gastric inhibitory polypeptide, GIP) in the management of obesity and type 2 diabetes has been controversial. Initial interest in the therapeutic use of GIP was dampened by evidence that its insulinotropic activity was reduced in type 2 diabetes and by reports that it increased glucagon secretion and adipose deposition in non-diabetic individuals.
Source: HEK293 cells
Tag: N-hFC
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
