ABclonal
Recombinant Human Gastrin-releasing peptide/GRP Protein - RP01845
Recombinant Human Gastrin-releasing peptide/GRP Protein - RP01845
Couldn't load pickup availability
Recombinant Human Gastrin-releasing peptide/GRP Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01845-10, RP01845-20, RP01845-50, RP01845-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Gastrin-releasing peptide/GRP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg22-Gly148) of human Gastrin-releasing peptide/GRP (Accession #) fused with a hFc tag at the C-terminus.
Alternate Names: BN; GRP-10; proGRP; preproGRP; Gastrin-releasing peptide; GRP; progastrin-releasing peptide
SWISS: P07492
GeneID: 2922
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Gastrin-releasing peptide (GRP) is a neuropeptide with growth-stimulatory and tumorigenic properties, and neuropeptides have previously been suggested to play a role in the complex cascade of chemical activity associated with periodontal inflammation.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: RAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
