Skip to product information
1 of 1

ABclonal

Recombinant Human GDF15 Protein - RP01950

Recombinant Human GDF15 Protein - RP01950

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human GDF15 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP01950-10, RP01950-20, RP01950-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human GDF15 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala197-Ile308)of Human GDF15 (Accession #NP_004855.2) fused with a hFc tag at the N-terminus.

Alternate Names: GDF15, MIC1, PDF, PLAB, PTGFB, Growth/differentiation factor 15, GDF-15, Macrophage inhibitory cytokine 1, MIC-1, NSAID-activated gene 1 protein, NAG-1, NSAID-regulated gene 1 protein, NRG-1, Placental TGF-beta, Placental bone morphogenetic protein, Prost

SWISS: Q99988

GeneID: 9518

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Growth-differentiation factor 15 (GDF15), also known as MIC-1, is a secreted member of the transforming growth factor (TGF)-β superfamily, as a novel antihypertrophic regulatory factor in the heart. GDF-15 / GDF15 is not expressed in the normal adult heart but is induced in response to conditions that promote hypertrophy and dilated cardiomyopathy and it is expressed highly in liver. GDF-15 / GDF15 has a role in regulating inflammatory and apoptotic pathways in injured tissues and during disease processes. GDF-15 / GDF15 is synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein. GDF-15 / GDF15 overexpression arising from an expanded erythroid compartment contributes to iron overload in thalassemia syndromes by inhibiting hepcidin expression.

Source: HEK293 cells

Tag: N-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details