Skip to product information
1 of 1

ABclonal

Recombinant Human GHRL/MTLRP Protein - RP01796

Recombinant Human GHRL/MTLRP Protein - RP01796

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human GHRL/MTLRP Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01796-10, RP01796-20, RP01796-50, RP01796-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human GHRL/MTLRP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Lys117) of human GHRL/MTLRP (Accession #NP_001128413.1) fused with RaFc tag at the C-terminus.

Alternate Names: GHRL; MTLRP

SWISS: Q9UBU3

GeneID: 51738

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility.

Source: HEK293 cells

Tag: C-Rabbit Fc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details