ABclonal
Recombinant Human GHRL/MTLRP Protein - RP01796
Recombinant Human GHRL/MTLRP Protein - RP01796
Couldn't load pickup availability
Recombinant Human GHRL/MTLRP Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01796-10, RP01796-20, RP01796-50, RP01796-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human GHRL/MTLRP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Lys117) of human GHRL/MTLRP (Accession #NP_001128413.1) fused with RaFc tag at the C-terminus.
Alternate Names: GHRL; MTLRP
SWISS: Q9UBU3
GeneID: 51738
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility.
Source: HEK293 cells
Tag: C-Rabbit Fc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
