Skip to product information
1 of 1

ABclonal

Recombinant Human Glycophorin-A/GYPA/CD235a protein - RP02835

Recombinant Human Glycophorin-A/GYPA/CD235a protein - RP02835

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Glycophorin-A/GYPA/CD235a protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02835-10, RP02835-20, RP02835-50, RP02835-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Glycophorin-A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Glu91) of human Glycophorin-A (Accession #NP_002090.4) fused with a hFc tag at the C-terminus.

Alternate Names: PAS-2; CD235a; GPA; GPErik; GpMiIII; GPSAT; GYPA; HGpMiIII; HGpMiV; HGpMiX; HGpMiXI; HGpSta(C); MNS; CD235a; MN

SWISS: P02724-1

GeneID: 2993

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Granulomatosis with polyangiitis (GPA) presents a wide spectrum of manifestations from the common respiratory symptoms to infrequent neurological and cardiac complications. The challenge in diagnosis and management makes the rapidly progressive disorder one of the most challenging dilemmas in clinical medicine.The ultimate goal is an improved prognosis through outcome measures which assesses the disease control with minimal adverse effects of intensive immunosuppressive regimens, an integral part of the clinical approach to improve the quality of life of GPA patients.

Bio-Activity: Anti-GPA Antibody immobilized on CM5 Chip can bind Human GPA, hFc Tag with an affinity constant of 0.72 μM as determined in SPR assay (Biacore T200).

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details