Recombinant Human GMF-Beta/GMFB Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00031-10, RP00031-20, RP00031-50, RP00031-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human GMF-Beta/GMFB Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser2-His142) of human GMF-beta (Accession #NP_004115.1).
Alternate Names: GMFB, GMF
SWISS: P60983
GeneID: 2764
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: GMFB is a nerve growth factor which belongs to the actin-binding proteins ADF family, GMF subfamily.GMFB is involved in nervous system development, angiogenesis and immune function. It is especially crucial for the nervous system. GMFB causes brain cell differentiation, stimulates neural regeneration and inhibits tumor cell proliferation. GMFB overexpression in astrocytes results in the increase of BDNF production.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only