ABclonal
Recombinant Human GOLPH2/GOLM1 Protein - RP01505
Recombinant Human GOLPH2/GOLM1 Protein - RP01505
Couldn't load pickup availability
Recombinant Human GOLPH2/GOLM1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01505-10, RP01505-20, RP01505-50, RP01505-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human GOLPH2/GOLM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser36-Leu401) of human GOLPH2/GOLM1 (Accession #NP_057632.2) fused with a 6×His tag at the C-terminus.
Alternate Names: C9orf155, GOLPH2, GP73, HEL46, PSEC0257, bA379P1.3, GOLM1, GOLPH2, GP73, HEL46, PSEC0257, bA379P1.3
SWISS: Q8NBJ4-1
GeneID: 51280
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Golgi membrane protein 1, also known as Golgi membrane protein GP73, Golgi phosphoprotein 2, and GOLM1, is a protein that belongs to the GOLM1 / CASC4 family. GOLM1 is widely expressed. It is highly expressed in the colon, prostate, trachea, and stomach. It is expressed at a lower level in testis, muscle, lymphoid tissues, white blood cells, and spleen. It is predominantly expressed by cells of the epithelial lineage. GOLM1 is expressed at a low level in the normal liver. Expression significantly increases in virus (HBV, HCV) infected liver. Expression of GOLM1 does not increase in liver disease due to non-viral causes (alcohol-induced liver disease, autoimmune hepatitis). Increased expression in hepatocytes appears to be a general feature of advanced liver disease. In liver tissue from patients with adult giant-cell hepatitis (GCH), GOLM1 is strongly expressed in hepatocyte-derived syncytial giant cells. GOLM1 is constitutively expressed by biliary epithelial cells but not by hepatocytes.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
