Recombinant Human HCVADR/CXADR Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00970-10, RP00970-20, RP00970-50, RP00970-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human HCVADR/CXADR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu20 - Gly237) of human CXADR/CAR (Accession #NP_001329.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CXADR, CAR, CAR4/6, HCAR
SWISS: P78310
GeneID: 1525
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CXADR (coxsackie and adenovirus receptor), also known as CAR, is a 46 kDa type I transmembrane glycoprotein that belongs to the CTX family of the Ig superfamily. CXADR has received attention as a receptor that facilitates gene transfer mediated by most adenoviruses. It is also an adhesion molecule within junctional complexes, notably between epithelial cells lining body cavities and within myocardial intercalated discs.It is expressed throughout brain neuroepithelium during development, but mainly in ependymal cells in the adult. The 365 amino acid (aa) human CXADR contains a 19 aa signal sequence, a 218 aa extracellular domain (ECD) with a V-type (D1) and a C2-type (D2) Ig-like domain, a 21 aa transmembrane segment and a 107 aa intracellular domain. D1 is thought to be responsible for homodimer formation in trans within tight junctions. The fiber knob of adenoviruses attaches at a similar site, and evidence suggests that disruption of tight junctions facilitates virus binding. The C-terminus interacts with several cytoplasmic junctional proteins, microtubules and the actin cytoskeleton.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only