Skip to product information
1 of 1

ABclonal

Recombinant Human HCVADR/CXADR Protein - RP00970

Recombinant Human HCVADR/CXADR Protein - RP00970

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human HCVADR/CXADR Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00970-10, RP00970-20, RP00970-50, RP00970-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human HCVADR/CXADR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu20 - Gly237) of human CXADR/CAR (Accession #NP_001329.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CXADR, CAR, CAR4/6, HCAR

SWISS: P78310

GeneID: 1525

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CXADR (coxsackie and adenovirus receptor), also known as CAR, is a 46 kDa type I transmembrane glycoprotein that belongs to the CTX family of the Ig superfamily. CXADR has received attention as a receptor that facilitates gene transfer mediated by most adenoviruses. It is also an adhesion molecule within junctional complexes, notably between epithelial cells lining body cavities and within myocardial intercalated discs.It is expressed throughout brain neuroepithelium during development, but mainly in ependymal cells in the adult. The 365 amino acid (aa) human CXADR contains a 19 aa signal sequence, a 218 aa extracellular domain (ECD) with a V-type (D1) and a C2-type (D2) Ig-like domain, a 21 aa transmembrane segment and a 107 aa intracellular domain. D1 is thought to be responsible for homodimer formation in trans within tight junctions. The fiber knob of adenoviruses attaches at a similar site, and evidence suggests that disruption of tight junctions facilitates virus binding. The C-terminus interacts with several cytoplasmic junctional proteins, microtubules and the actin cytoskeleton.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details