ABclonal
Recombinant Human HMGB2 Protein - RP01718
Recombinant Human HMGB2 Protein - RP01718
Couldn't load pickup availability
Recombinant Human HMGB2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01718-10, RP01718-20, RP01718-50, RP01718-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human HMGB2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu209) of human HMGB2 (Accession #NP_001124160.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: HMG-1, HMG1, HMG3, SBP-1
SWISS: P26583
GeneID: 3148
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: High mobility group protein B2, also known as HMGB2, is a member of the non-histone chromosomal high-mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
