ABclonal
Recombinant Human HTRA2 Protein - RP00041
Recombinant Human HTRA2 Protein - RP00041
Couldn't load pickup availability
Recombinant Human HTRA2 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00041-10, RP00041-20, RP00041-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human HTRA2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala134-Glu458) of human HTRA2/Omi (Accession #NP_037379.1).
Alternate Names: HTRA2, MGCA8, OMI, PARK13, PRSS25, OMI, PARK13, PRSS25
SWISS: O43464
GeneID: 27429
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a serine protease. It has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed.
Bio-Activity: Protease activity demonstrated by HtrA2 cleavage of bovine β-casein (Sigma, Catalog # C-6905). Incubation of β-casein at 0.2 mg/mL with Recombinant Human HTRA-2 at 0.02 mg/mL (ratio of 10:1) for 60 minutes at 45℃ in 50 mM Tris, pH 8.0, which results in >95% cleavage of β-casein, as revealed by SDS-PAGE.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Endotoxin: Please contact us for more information.
Research Use Only
