Skip to product information
1 of 1

ABclonal

Recombinant Human ICOS/CD278 Protein - RP01401

Recombinant Human ICOS/CD278 Protein - RP01401

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human ICOS/CD278 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01401-10, RP01401-20, RP01401-50, RP01401-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human ICOS/CD278 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Phe141) of human ICOS/CD278 (Accession #NP_036224.1) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: AILIM, CD278, CVID1, ICOS, CD278, CVID1

SWISS: Q9Y6W8

GeneID: 29851

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Inducible costimulator (ICOS), also called AILIM (Activation-Inducible Lymphocyte Immunomediatory Molecule) is a cell-surface receptor and belongs to the CD28 family of immune costimulatory receptors consisting of CD28, CTLA-4, and PD-1. The interaction of B7-H2/ICOS plays a critical role in Th cell differentiation, T?B cell interactions which are essential for the germinal center formation, and humoral immune responses, and as well as the production of cytokine IL-4. Also, ICOS is more potent in the induction of IL-10 production, a cytokine important for the suppressive function of T regulatory cells. The B7-1/B7-2--CD28/CTLA-4 and ICOS-B7RP-1 pathway provide key second signals that can regulate the activation, inhibition, and fine-tuning of T-lymphocyte responses. ICOS stimulates both Th1 and Th2 cytokine production but may have a preferential role in Th2 cell development. Moreover, The B7-1/B7-2-CD28/CTLA-4 and ICOS-B7RP-1 pathway has been suggested as being involved in the development of airway inflammation and airway hyperresponsiveness.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized human B7-H2/ICOSLG at 1 μg/mL (100 μL/well) can bind Human ICOS/CD278 with a linear range of 2-14.8 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details