WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IFN-alpha 1/13(Q114A) Protein - RP00011

Recombinant Human IFN-alpha 1/13(Q114A) Protein - RP00011

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human IFN-alpha 1/13(Q114A) Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00011-10, RP00011-20, RP00011-50, RP00011-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IFN-alpha 1/13(Q114A) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Glu189 (Ala114)) of human IFNA1 (Accession #NP_076918.1) fused with an initial Met at the N-terminus and a 6×His tag at the C-terminus.

Alternate Names: IFNA1, IFL, IFN, IFN-ALPHA, IFN-alphaD, IFNA13, IFNA

SWISS: P01562

GeneID: 3439

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IFNA1, also known as IFN-alpha and IFNA, belongs to the alpha/beta interferon family. Interferons(IFNs) are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, parasites or tumor cells.Leukocyte interferon is produced predominantly by B lymphocytes. Immune interferon is produced by mitogen- or antigen-stimulated T lymphocytes. IFNA1 is produced by macrophages and has has both anti-viral and immunomodulatory activities on target cells.

Bio-Activity: Measured by its ability to stimulate GBP2 expression in 293T human embryonic kidney cells. 0.1-1 ng/mL of Recombinant Human IFNA1 can effectively Stimulating GBP2 expression.|2.Measured by its ability to stimulate human colon adenocarcinoma cells (Caco-2 cells). 10 ng/μL of Recombinant Human IFN-alpha 1/13(Q114A) can upregulate the expression of MDA5.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYAQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only