Recombinant Human IFN-alpha 2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01432-10, RP01432-20, RP01432-50, RP01432-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IFN-alpha 2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Glu188) of human Interferon alpha 2/IFNA2 (Accession #NP_000596.2) fused with a 6×His tag at the C-terminus.
Alternate Names: IFNA2, IFN-alphaA, IFNA, IFNA2B, INFA2, interferon alpha-2, Interferon alpha 2 (IFN-α2) , IFN-alphaA, IFNA, IFNA2B, INFA2
SWISS: P01563
GeneID: 3440
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IFNA2 (Interferon Alpha 2) is a Protein Coding gene. This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Type I Interferons (IFNs) are well-known cytokines that exert antiviral activity, antitumor activity, and immunomodulatory effects. Interferon tau (IFNT), a type I IFN similar to alpha IFNs (IFNA), is the pregnancy recognition signal produced by the ruminant conceptus. Among the IFN-α genes, a total of 28 different sequence variants have been described. The three principal subtypes of IFNα-2 are designated α-2a, α-2b, and α-2c. IFNα-2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human IFNA2 at 2 μg/mL (100 μL/well) can bind Human IFNAR2 with a linear range of 0.2-617ng/mL.|2.Recombinant human IFN-α2 (10 ng/mL) was used to treat HCT116 cells. Western-blot result showed that both the level of phosphorylated STAT1 and STAT3 were increased, indicating the stimulation was successful.(Customer Feedback Data)
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Endotoxin: Please contact us for more information.
Research Use Only