ABclonal
Recombinant Human IFN-alpha 21 Protein - RP01900
Recombinant Human IFN-alpha 21 Protein - RP01900
Regular price
$210.00 CAD
Regular price
Sale price
$210.00 CAD
Quantity
Couldn't load pickup availability
Recombinant Human IFN-alpha 21 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01900-10, RP01900-20, RP01900-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IFN-alpha 21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Glu189) of Human IFN-alpha 21/IFNA21 (Accession #NP_002166.2) fused with a His tag at the C-terminus.
Alternate Names: IFNA21; IFN-alpha 21; IFNalpha F; IFN-alpha F; IFN-alpha-21; IFN-alphaI; interferon alpha-21; Interferon alpha-F; interferon, alpha 21; LeIF F; leukocyte interferon protein; MGC126687; MGC126689
SWISS: P01568
GeneID: 3452
Species: Human
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interferons (IFN) are a family of cytokines with potent antiviral, anti-proliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Human IFNA2 was originally cloned in the early ‘80s and now more than a dozen closely related IFN alpha subtypes have been identified in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology. Structurally, type I IFNs belong to the class of five helicalbundle cytokines, with the IFNA subtypes containing 2 conserved disulfide bonds. There is not a mouse homolog for IFNA21, but mature human IFNA21 is identical to chimpanzee IFNA21. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit). Individual IFNA subtypes are known to display unique efficacies to viral protection, with IFNA21 displaying intermediate activity inducing interferon stimulating genes. Further, human IFNA21 has shown weak anti-viral activity against viruses such as metapneumovirus.
Bio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 0.50‑1.98 ng/mL, corresponding to a specific activity of 5.05×10^5 ~2.00×10^6 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
View full details
