Recombinant Human IFN-gamma R1/CD119 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00200-10, RP00200-20, RP00200-50, RP00200-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IFN-gamma R1/CD119 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly245) of human IFNGR1/CD119 (Accession #NP_000407.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CD119, IFNGR, IMD27A, IMD27B, IFNGR1, CD119, interferon gamma receptor 1, IFNGR, IMD27A, IMD27B
SWISS: P15260
GeneID: 3459
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The high-affinity IFN-gamma receptor complex is made up of two type I membrane proteins, IFN-gammaR1 (IFN gamma R alpha ) and IFN-gammaR2 (IFN-gamma R beta ). IFN-gamma R1 is the ligand-binding subunit that is necessary and sufficient for IFN-gamma binding and receptor internalization. IFN-gammaR2 is required for IFN gamma signaling but does not bind IFN-gamma by itself. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FNGR1/CD119 at 1 μg/mL (100 μL/well) can bind Human IFNG with a linear range of 0.98-1.97 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only