Recombinant Human IFN-lambda 2/IL-28A Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00231-10, RP00231-20, RP00231-50, RP00231-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IFN-lambda 2/IL-28A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val26-Val200) of human IL-28A/IL28A (Accession #NP_742150.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IFNL2, IL-28A, IL28A, IFNL2a, IFNL3a, IL-28A
SWISS: Q8IZJ0
GeneID: 282616
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IL 28A (Interferon-lambda 2; IFN-lambda 2), IL-28B/IFN-lambda 3, and IL-29/IFN-lambda 1 are type III interferons which are distantly related to IL-10 family and type I IFN family cytokines. IL 28A ,interleukin 28B (IL28B), and interleukin 29 (IL29) are three closely related cytokine which are expression can be induced by viral infection.In the liver, the IL-28A induced Th1 cytokine response contributes to inflammation in T cell mediated hepatitis. IL-28A additionally exhibits anti-tumor activity, in part by enhancing IL-12 dependent anti-tumor CTL responses in vivo. In contrast, it is up-regulated in invasive bladder cancer where it promotes tumor cell migration.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only