ABclonal
Recombinant Human IFN-lambda 3/IL-28B Protein - RP00219
Recombinant Human IFN-lambda 3/IL-28B Protein - RP00219
Couldn't load pickup availability
Recombinant Human IFN-lambda 3/IL-28B Protein
Sizes: 10ug, 20ug
Catalogue Number: RP00219-10, RP00219-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IFN-lambda 3/IL-28B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Val196) of human IFNL3/IL28B/Interleukin-28B (Accession #NP_742151.2) fused with a 6×His tag at the C-terminus.
Alternate Names: IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C
SWISS: Q8IZI9
GeneID: 282617
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-28B (IL-28B) also known as Interferon lambda-3 and IFN-lambda-3, belongs to the type III interferon family of cytokines. IL-28B is a cytokine with immunomodulatory activity. It functions in Up-regulating MHC class I antigen expression. IL-28B displays potent antiviral activity and antitumor activity. This cytokine serves as ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. IL-28B is able to increase the percentage of splenic CD8+ T cells in vaccinated animals and have higher antigen-specific cytolytic.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL28B at 2 μg/mL (100 μL/well) can bind Recombinant Human IL10RB with a linear range of 0.25-1 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,500mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
