Skip to product information
1 of 1

ABclonal

Recombinant Human IFN-lambda 3/IL-28B Protein - RP00219

Recombinant Human IFN-lambda 3/IL-28B Protein - RP00219

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IFN-lambda 3/IL-28B Protein

Sizes: 10ug, 20ug

Catalogue Number: RP00219-10, RP00219-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IFN-lambda 3/IL-28B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Val196) of human IFNL3/IL28B/Interleukin-28B (Accession #NP_742151.2) fused with a 6×His tag at the C-terminus.

Alternate Names: IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C

SWISS: Q8IZI9

GeneID: 282617

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin-28B (IL-28B) also known as Interferon lambda-3 and IFN-lambda-3, belongs to the type III interferon family of cytokines. IL-28B is a cytokine with immunomodulatory activity. It functions in Up-regulating MHC class I antigen expression. IL-28B displays potent antiviral activity and antitumor activity. This cytokine serves as ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. IL-28B is able to increase the percentage of splenic CD8+ T cells in vaccinated animals and have higher antigen-specific cytolytic.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL28B at 2 μg/mL (100 μL/well) can bind Recombinant Human IL10RB with a linear range of 0.25-1 μg/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,500mM NaCl, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details