ABclonal
Recombinant Human IgE Protein - RPT0015
Recombinant Human IgE Protein - RPT0015
Couldn't load pickup availability
Recombinant Human IgE Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RPT0015-20, RPT0015-50, RPT0015-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser106-Gly427) of Human IgE (Accession #AAB59395.1 ) fused with a His tag at the C-terminus.
Alternate Names: Immunoglobulin heavy constant epsilon, Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE, IgE
SWISS: P01854
GeneID: 3497
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to be located in extracellular region. Predicted to be part of immunoglobulin complex, circulating. Predicted to be active in external side of plasma membrane.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IgE (Catalog: RTP0015) at 1 μg/mL (100 μL/well) can bind Human IgE Rabbit mAb (Catalog: A23194) with a linear range of 0.06-0.6 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
