WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IGF-I Protein - RP00996

Recombinant Human IGF-I Protein - RP00996

Regular price
$140.00
Regular price
Sale price
$140.00
Unit price
per 
Availability
Sold out

Recombinant Human IGF-I Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00996-10, RP00996-20, RP00996-50, RP00996-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IGF-I Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence ( Gly 49 - Ala 118) of human IGF1 (Accession #NP_001104755.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: IGF1, IGF-I, IGFI, MGF, IGFI, MGF

SWISS: P05019-1

GeneID: 3479

Species: Human

Purity: ≥ 85 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its ability to stimulate p70 S6 Kinase(Thr389) and p85 S6 Kinase(Thr412) autophosphorylation in 293T human embryonic kidney cells. 0.01-1 ng/mL of Recombinant Human IGF1 can effectively enhance p70 S6 Kinase(Thr389) and p85 S6 Kinase(Thr412) autophosphorylation.|2.Measured by its binding ability in a functional ELISA. Immobilized recombinant human IGFBP6 at 1 μg/mL (100 μL/well) can bind recombinant human IGF1 with a linear range of 30-250 ng/mL. 3.Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is typically 7.5-30 ng/mL, corresponding to a specific activity of 3.33×10^4 -1.33×10^5 units/mg.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only