Recombinant Human IGF-II Protein - RP01878

Recombinant Human IGF-II Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01878-10, RP01878-20, RP01878-50, RP01878-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IGF-II Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Glu91) of human IGF2 (Accession #P01344)fused with a hFc tag at the C-terminus.

Alternate Names: IGF2, C11orf43, GRDF, IGF-II, PP9974

SWISS: P01344-1

GeneID: 3481

Species: Human

Purity: ≥ 85% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein belongs a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.2 μm filtered solution of 50mMTris, 100mM Glycine, pH7.5.

Antigen Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only