ABclonal
Recombinant Human IGF-II Protein - RP01878
Recombinant Human IGF-II Protein - RP01878
Couldn't load pickup availability
Recombinant Human IGF-II Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01878-10, RP01878-20, RP01878-50, RP01878-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IGF-II Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Glu91) of human IGF2 (Accession #P01344)fused with a hFc tag at the C-terminus.
Alternate Names: IGF2, C11orf43, GRDF, IGF-II, PP9974
SWISS: P01344-1
GeneID: 3481
Species: Human
Purity: ≥ 85% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein belongs a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.2 μm filtered solution of 50mMTris, 100mM Glycine, pH7.5.
Antigen Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
