Skip to product information
1 of 1

ABclonal

Recombinant Human IGFBP-1 Protein - RP00237

Recombinant Human IGFBP-1 Protein - RP00237

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IGFBP-1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00237-10, RP00237-20, RP00237-50, RP00237-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IGFBP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Asn259) of human IGFBP-1 (Accession #NP_000587.1) fused with a 6×His tag at the C-terminus.

Alternate Names: AFBP, IBP1, IGF-BP25, PP12, hIGFBP-1, IGFBP1, IBP1, IGF-BP25, PP12, hIGFBP-1

SWISS: P08833

GeneID: 3484

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-transitional modifications of IGFBP, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IGFBP-1 at 5 μg/mL (100 μL/well) can bind Recombinant Human IGF1 with a linear range of 44-176 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details