ABclonal
Recombinant Human IGFBP-6 Protein - RP00145
Recombinant Human IGFBP-6 Protein - RP00145
Couldn't load pickup availability
Recombinant Human IGFBP-6 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00145-10, RP00145-20, RP00145-50, RP00145-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IGFBP-6 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly240) of human IGFBP6/IBP-6 (Accession #NP_002169.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IGFBP6, IBP6
SWISS: P24592
GeneID: 3489
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, they can bind IGF-I and IGF-II with the equal affinity. Insulin-like growth factor (IGF) binding proteins (IGFBPs) have been shown to either inhibit or enhance the action of IGF, or act in an IGF-independent manner in the prostate. IGF-binding protein-4 (IGFBP-4) inhibits IGF-I action in vitro and is the most abundant IGFBP in the rodent arterial wall. IGFBP6 is directly downregulated by the beta-catenin/TCF complex in desmoid tumors, and imply a role for the IGF axis in the proliferation of desmoid tumors. There is mounting evidence that the structure of the IGFBP proteins plays a key role in the regulation of IGF bioavailability, by modulating its molecular size, capillary membrane permeability, target tissue specificity, cell membrane adherence and IGF affinity.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant human IGFBP6 at 1 μg/mL (100 μL/well) can bind recombinant human IGF1 with a linear range of 30-250 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
