WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IGFBP-8/CTGF Protein - RP01113

Recombinant Human IGFBP-8/CTGF Protein - RP01113

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human IGFBP-8/CTGF Protein

Sizes: 10ug, 50ug

Catalogue Number: RP01113-10, RP01113-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IGFBP-8/CTGF Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln27-Ala180) of human CTGF (Accession #P29279) fused with no tags.

Alternate Names: CTGF, CCN2, HCS24, IGFBP8, NOV2

SWISS: P29279

GeneID: 1490

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.

Source: HEK293 cells

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only