Recombinant Human IgG3 Protein
Sizes: 50ug, 100ug
Catalogue Number: RPT0006-50, RPT0006-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IgG3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu99-Lys377) of human IgG3 (Accession #) fused with no additional amino acid.
Alternate Names: IgG3
SWISS: P01860
GeneID: 3502
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IGHG3 (Immunoglobulin Heavy Constant Gamma 3 (G3m Marker), also known as IgG3) is a Protein Coding gene. Ig gamma-3 chain C region is a protein that in humans is encoded by the IGHG3 gene. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Murine immunoglobulin G (IgG) plays an important role in mediating protective immune responses to malaria. Diseases associated with IGHG3 include Heavy Chain Disease and Gamma Heavy Chain Disease. Among its related pathways are IL4-mediated signaling events and the Creation of C4 and C2 activators.
Source: HEK293 cells
Tag: NO-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only