Skip to product information
1 of 1

ABclonal

Recombinant Human IL-1 alpha Protein - RP03505

Recombinant Human IL-1 alpha Protein - RP03505

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-1 alpha Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP03505-10, RP03505-20, RP03505-50, RP03505-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-1 alpha Protein is produced by E. coli Cells system. The target protein is expressed with sequence (Ser113-Ala271) of Human IL-1 alpha (Accession #NP_000566.3) fused with No tag.

Alternate Names: IL1A, IL1F1, Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1

SWISS: P01583

GeneID: 3552

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.

Bio-Activity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 9.39-37.58 pg/mL, corresponding to a specific activity of 2.66×10^7~1.06×10^8 units/mg.

Source: E. coli

Tag: NO-Tag

Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).

Antigen Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Endotoxin: Please contact us for more information.

Research Use Only

View full details