WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IL-1 beta Protein - RP00002

Recombinant Human IL-1 beta Protein - RP00002

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human IL-1 beta Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00002-10, RP00002-20, RP00002-50, RP00002-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-1 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala117-Ser269) of human IL-1 beta (Accession #NP_000567.1) fused with an initial Met at the N-terminus and a 6×His tag at the C-terminus.

Alternate Names: IL-1, IL1-BETA, IL1F2, IL1 beta, IL1B

SWISS: P01584

GeneID: 3553

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.

Bio-Activity: 1.Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 6.04-24.16 pg/mL, corresponding to a specific activity of 4.14×10^7~1.66×10^8 units/mg.|2.Measured by its binding ability in a functional ELISA. Immobilized Human IL-1 beta (Catalog: RP00002) at 10 μg/mL (100 μL/well) can bind Biotinylated Human IL-1R1 (Catalog: RP01036) with a linear range of 0.002-1 μg/mL.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only