ABclonal
Recombinant Human IL-10 Protein - RP00093
Recombinant Human IL-10 Protein - RP00093
Couldn't load pickup availability
Recombinant Human IL-10 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00093-10, RP00093-20, RP00093-50, RP00093-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-10 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser19-Asn178) of human IL10/Interleukin-10 (Accession #NP_000563.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CSIF, GVHDS, IL-10, IL10A, TGIF, IL10, GVHDS, IL-10, IL10A, TGIF
SWISS: P22301
GeneID: 3586
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.
Bio-Activity: 1.Measured in a cell proliferation assay using MC/9-2 mouse mast cells. The ED50 for this effect is 0.13-0.52 ng/mL, corresponding to a specific activity of 1.92×10^6 -7.69×10^6 units/mg.|2.Measured by its binding ability in a functional ELISA.Immobilized Human IL10 (Catalog: RP00093) at 2 μg/mL (100 μL/well) can bind Human IL10RA (Catalog: RP01648) with a linear range of 0.1-2.9 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
