Skip to product information
1 of 1

ABclonal

Recombinant Human IL-10 Protein - RP00093

Recombinant Human IL-10 Protein - RP00093

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human IL-10 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00093-10, RP00093-20, RP00093-50, RP00093-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-10 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser19-Asn178) of human IL10/Interleukin-10 (Accession #NP_000563.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CSIF, GVHDS, IL-10, IL10A, TGIF, IL10, GVHDS, IL-10, IL10A, TGIF

SWISS: P22301

GeneID: 3586

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.

Bio-Activity: 1.Measured in a cell proliferation assay using MC/9-2 mouse mast cells. The ED50 for this effect is 0.13-0.52 ng/mL, corresponding to a specific activity of 1.92×10^6 -7.69×10^6 units/mg.|2.Measured by its binding ability in a functional ELISA.Immobilized Human IL10 (Catalog: RP00093) at 2 μg/mL (100 μL/well) can bind Human IL10RA (Catalog: RP01648) with a linear range of 0.1-2.9 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details