Recombinant Human IL-12/IL-12A&IL-12B Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01232-10, RP01232-20, RP01232-50, RP01232-100
Citations, Manuals and MSDS Available upon request.
Description: Active Recombinant Human IL-12A&IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile23-Ser328&Arg23-Ser219) of human IL-12 (Accession #NP_002178.2/NP_000873.2) fused with a 6×His tag at the C-terminus(IL12B),Flag tag at the C-terminus(IL12A).
Alternate Names: CLMF, IL12, p70, Interleukin-12, IL12A, P35, NKSF
SWISS: P29459&P29460
GeneID: 3592&3593
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL-12 at 1 μg/mL (100 μL/well) can bind Recombinant Human IL12Rβ1 with a linear range of 30.6-122.4 ng/mL.|2.Measured in a cell proliferation assay using anti-CD3 antibody activated Human T lymphocyte leukemia cells (jurkat). The ED50 for this effect is typically 0.1-0.4 ng/mL, corresponding to a specific activity of 2.5×10^6 -1.0×10^7units/mg.|3.Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 2-8 ng/mL, corresponding to a specific activity of 1.25×10^5 ~5×10^5 units/mg.
Source: HEK293 cells
Tag: C-His(IL12B)&C-Flag(IL12A)
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS//RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only